DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and atp1b3b

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_571745.1 Gene:atp1b3b / 64272 ZFINID:ZDB-GENE-001127-1 Length:275 Species:Danio rerio


Alignment Length:321 Identity:65/321 - (20%)
Similarity:117/321 - (36%) Gaps:111/321 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   581 RTEWRRLFFNKIHGKYKLRRPSHW-LYTLVFSVLYILFVIIFSMAWFDFIK--DDASRKVPMIKM 642
            ::.|:...:|...|::..|..|.| |..|.:.|.|.....:|::..:..::  ||.:.|. ..::
Zfish    12 QSSWKDFIYNPRTGEFIGRTASSWALIFLFYLVFYGFLAGMFTLTMWVMLQTLDDHTPKY-RDRV 75

  Fly   643 AQPFISFTPIGPRTNPKAVSFDPRNSTEVMEKYA-GIMALLEKYGD---YGHNP----------- 692
            |.|.:.   |.||:  ..::|: |:..:...||. .:.|.|:.|.|   ..:.|           
Zfish    76 ANPGLM---IRPRS--LDIAFN-RSIPQQYSKYVQHLEAFLQSYNDSLQEANEPCQEGMYFEQDD 134

  Fly   693 ------------RFGTCT--ANEKFGYPSGEPCVFLKVNRIIGFKT--EPYINSDELVKAKIDEV 741
                        :...|:  ::..|||..|.||:.:|:||:||.|.  :|:              
Zfish   135 VEEKKVCQFKRSQLRQCSGLSDTTFGYSEGNPCIIVKMNRVIGLKPRGDPH-------------- 185

  Fly   742 EFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEEKIEYIANEGK-- 804
                                   |.|....|..:.::.:|:                   |||  
Zfish   186 -----------------------IACTVKGDGTLQMQLYPD-------------------EGKID 208

  Fly   805 KSFF-------GPNDVNRIVALKIKNLKANERVH--INCKMWAQ---NIHHRKEGYGQVSF 853
            ||||       ..|.|..:||:|:...:.:..:.  :.||:...   |...|.:..|:|:|
Zfish   209 KSFFPYYGKILHKNYVQPLVAVKLMLGENDYNIEHTVECKVEGSDLLNNDERDKFLGRVTF 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 33/159 (21%)
atp1b3bNP_571745.1 Na_K-ATPase 10..268 CDD:278704 63/318 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.