DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and atp1b2a

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:XP_021325519.1 Gene:atp1b2a / 64269 ZFINID:ZDB-GENE-001127-2 Length:293 Species:Danio rerio


Alignment Length:349 Identity:72/349 - (20%)
Similarity:116/349 - (33%) Gaps:153/349 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 WRRLFFNKIHGKYKLRRPSHW----LYTLVF---------SVLYILFVII--FSMAWFDFIKDDA 633
            |:..|:|....:...|..|.|    |:.|||         ..:|::.:.:  :...|.|      
Zfish    13 WKDFFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGVFCLTMYVMLLTLDDYQPTWQD------ 71

  Fly   634 SRKVPMIKMAQPFISFTPIGPRTNPKAVSFD---PRNSTEVMEKYA-GIMALLEKY--------- 685
                   ::|.|       |....||..:.:   .|.:||..|.|. .:.:.|:.|         
Zfish    72 -------RLATP-------GMMIRPKGEALEIVYSRENTESWELYVQALDSFLKPYNNSQQAVNN 122

  Fly   686 --------------GDYGHNP----RFGTCT-------ANEKFGYPSGEPCVFLKVNRIIGFK-- 723
                          |:..:||    ||...|       .:..:|||.|:||:.:|:||:||.|  
Zfish   123 DDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKPCILIKLNRVIGMKPG 187

  Fly   724 ---TEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAI 785
               ..||                                     :||.:.:.|            
Zfish   188 KDGQSPY-------------------------------------VTCGAKRYK------------ 203

  Fly   786 RTEYTDIEEKIEYIANEGKKSFFGPN---------------DVN---RIVALKIKNLKANERVHI 832
              |..:.:|..|.|   |:.::|.||               .||   .:||:|..|:..|..|::
Zfish   204 --EGDEWKEDAESI---GEIAYFPPNGTFNLMYYPYYGMKAQVNYSQPLVAVKFMNISFNTDVNV 263

  Fly   833 NCKMWAQNI---HHRKEGYGQVSF 853
            .||:.:..|   ..|.:..|:|||
Zfish   264 ECKINSNTITEFSERDKFAGRVSF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 37/169 (22%)
atp1b2aXP_021325519.1 Na_K-ATPase 7..287 CDD:306737 70/347 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.