DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and ATP1B1

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001668.1 Gene:ATP1B1 / 481 HGNCID:804 Length:303 Species:Homo sapiens


Alignment Length:323 Identity:70/323 - (21%)
Similarity:120/323 - (37%) Gaps:95/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 WRRLFFNKIHGKYKLRRPSHWLYTLVFSVLY---------------ILFVIIFSMAWFDFIKDDA 633
            |::..:|....::..|....|...|:|.|::               :|.:..|...:.|.:....
Human    12 WKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPG 76

  Fly   634 SRKVPMIKMAQPFISFTPIGPRTNPKAVSFDPRNSTEVMEKY--------------AGIMALLEK 684
            ..::|.|:..:  |||.|    .:||:......|....:|||              ..:.:..::
Human    77 LTQIPQIQKTE--ISFRP----NDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKE 135

  Fly   685 YGDYGHNP------RF-----GTCTA--NEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKA 736
            .||:.|..      ||     |.|:.  :|.:||..|:||:.:|:||::|||.:|..|..     
Human   136 RGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNES----- 195

  Fly   737 KIDEVEFTALKRLLENTTTEEGHLNRTWITCR----SDKDK--NVLIEFHPEPAIRTEYTDIEEK 795
                         ||.....:.:.|...:.|.    .||||  ||            ||..:...
Human   196 -------------LETYPVMKYNPNVLPVQCTGKRDEDKDKVGNV------------EYFGLGNS 235

  Fly   796 ----IEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNIHHRKEGYGQVSFF 854
                ::|....||  ...|..:..::|::..||..:..:.|.||.:.:||     ||.:...|
Human   236 PGFPLQYYPYYGK--LLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENI-----GYSEKDRF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 37/153 (24%)
ATP1B1NP_001668.1 Na_K_ATPase_bet 1..303 CDD:273446 70/323 (22%)
immunoglobulin-like 191..303 28/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5606
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.