DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and atp1b3

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_989087.1 Gene:atp1b3 / 394687 XenbaseID:XB-GENE-485127 Length:279 Species:Xenopus tropicalis


Alignment Length:340 Identity:78/340 - (22%)
Similarity:130/340 - (38%) Gaps:115/340 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 KEDRRTYYKGCEYHFPGRTEWRRLFFNKIHGKYKLRRPSHWLYTLVFSVLYILFVI-IFSMAWFD 627
            ||:.    ||.|   ...::|::..:|...|::..|..|.|...|:|.:::..|:. :|::..:.
 Frog     3 KEEN----KGSE---QSGSDWKQFIYNPQSGEFMGRTASSWALILLFYLVFYGFLAGLFTLTMWV 60

  Fly   628 FIK--DDASRKVPMI--KMAQPFISFTPIGPRTNPKAVSFD---PRNSTEVMEKYAGIM-ALLEK 684
            .::  ||:   ||..  :::.|       |...:||:...:   .||.|:..::|...: ..|..
 Frog    61 MLQTLDDS---VPKYRDRVSSP-------GLMISPKSAGLEIKFTRNKTQSYQEYIQTLHTFLTP 115

  Fly   685 YGD--------------------------YGHNPRFGTCTANE--KFGYPSGEPCVFLKVNRIIG 721
            |.|                          ..:....|.|:..|  .|||..|:|||.:|:|||||
 Frog   116 YNDAIQAKNDLCAPGLYFDQDEKDEKKACQFNRSSLGLCSGIEDNTFGYNEGKPCVIVKMNRIIG 180

  Fly   722 FKTE--PYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPA 784
            .|.|  |.||                                     |.| |.::|.:::.||  
 Frog   181 LKPEGNPKIN-------------------------------------CTS-KTEDVNLQYFPE-- 205

  Fly   785 IRTEYTDIEEKIE--YIANEGKKSFFGPNDVNRIVALKIKNLKAN---ERVHINCKMWA----QN 840
                    ..||:  |....|||:..  |.|..:||:||.....|   :.:.:.||:..    :|
 Frog   206 --------NGKIDLMYFPYYGKKTHV--NYVQPLVAVKIIPPPYNSSLDEISLECKIHGSRNLKN 260

  Fly   841 IHHRKEGYGQVSFFV 855
            ...|.:..|:|:|.|
 Frog   261 EDERDKFLGRVTFKV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 41/154 (27%)
atp1b3NP_989087.1 Na_K-ATPase 14..272 CDD:366001 70/317 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.