DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and nrv2

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001014475.1 Gene:nrv2 / 33953 FlyBaseID:FBgn0015777 Length:323 Species:Drosophila melanogaster


Alignment Length:381 Identity:83/381 - (21%)
Similarity:137/381 - (35%) Gaps:119/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 DGTDVIYMHPIKTDRKKLNKLIVDPPPDNGPYKMPTKEDRRTYYKGCEYHFPGRT--EWRRLFFN 590
            ||....|..|.:..:||..|.:|....||            :|:        ||:  .|.::.. 
  Fly    10 DGFQQYYSRPPERPKKKSLKQMVYDSEDN------------SYF--------GRSMDSWAKIGI- 53

  Fly   591 KIHGKYKLRRPSHWLYTLVFSVLYILFVIIFSMAWFDFIKDDASRKVPMIKM------AQPFISF 649
                          .|...:.||..| |.|...|:|..:    ..::|...:      ..|.:.|
  Fly    54 --------------FYVAFYGVLAAL-VAICMWAFFQTL----DPRIPKWTLDRSLIGTNPGLGF 99

  Fly   650 TPIGPRTNPKAVSF--------DPRNSTEVMEKYAGIM---ALLEKYG------DYGHNPRFG-- 695
            .|:.|..|.::...        :.::.|:.::.:..:.   .|....|      ||...|..|  
  Fly   100 RPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQV 164

  Fly   696 ---------TCTANEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDEL-------VKAKIDEVEFT 744
                     .||....:.|....||:|||:|:|.|:..|.|..|::|       :|..|.|||  
  Fly   165 CDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVE-- 227

  Fly   745 ALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEE--KIEYIANEGKKSF 807
                     .|:...||..|::|..:           .||      |.|.  .:.|:...|...:
  Fly   228 ---------KTQPEKLNTIWVSCEGE-----------NPA------DQENIGAVNYLPIRGFPGY 266

  Fly   808 FGPND-----VNRIVALKIKNLKANERVHINCKMWAQN-IHHRKEGYGQVSFFVLL 857
            |.|..     ::.:||:..:..|....:::.|:.||:| ||.|||..|.|.:.:|:
  Fly   267 FYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 42/158 (27%)
nrv2NP_001014475.1 Na_K-ATPase 24..317 CDD:278704 77/360 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5606
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.