DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and nrv1

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001260163.1 Gene:nrv1 / 33952 FlyBaseID:FBgn0015776 Length:309 Species:Drosophila melanogaster


Alignment Length:336 Identity:77/336 - (22%)
Similarity:138/336 - (41%) Gaps:87/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 KGCEYHFP---GRTEWRRLFFNKIHGKYKLRRPSHWLYTLVF-SVLYILFVIIFSMAWFDFIKDD 632
            || |:.||   .:..:..:.:|...|.:..|....|...|:| ::.||:...:|::. ...:...
  Fly    10 KG-EFEFPQPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTIC-MQGLLST 72

  Fly   633 ASRKVPMIKM------AQPFISFTPIGPRT-NPKAVSFDPR-------------------NSTEV 671
            .|...|..|:      ..|.:.|.|:..:| ....::||.:                   |.||.
  Fly    73 ISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEG 137

  Fly   672 ME-KYAGIMALLEKYGDYGHNPR---------FGTCTANEKFGYPSGEPCVFLKVNRIIGFKTEP 726
            .: |:.|...:||        |.         ||.|:....:||.:.:||:|||:|:|.|:..|.
  Fly   138 RDMKHCGFGQVLE--------PTDVCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEV 194

  Fly   727 YINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRS--DKDKNVLIEFHPEPAIRTEY 789
            |   |:..|...|:     ||:::..|.|||  ..:.|::|..  .|||...             
  Fly   195 Y---DKEEKDMPDD-----LKKVINETKTEE--RQQVWVSCNGHLGKDKENF------------- 236

  Fly   790 TDIEEKIEYIANEGKKSFF-----GPNDVNRIVALKIKNLKANERVHINCKMWAQNIHHR---KE 846
                :.|.|..::|..|::     .|..::.:||::..:....:.:.:.|:.||:||.:.   ::
  Fly   237 ----QNIRYFPSQGFPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRD 297

  Fly   847 GYGQVSFFVLL 857
            ..|.|:|.:||
  Fly   298 RKGSVTFQILL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 38/153 (25%)
nrv1NP_001260163.1 Na_K-ATPase 20..303 CDD:278704 68/318 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5606
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.