DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Atp1b1

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_037245.2 Gene:Atp1b1 / 25650 RGDID:2170 Length:304 Species:Rattus norvegicus


Alignment Length:327 Identity:67/327 - (20%)
Similarity:120/327 - (36%) Gaps:102/327 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 WRRLFFNKIHGKYKLRRPSHWLYTLVFSVLY---------------ILFVIIFSMAWFDFIKDDA 633
            |::..:|....::..|....|...|:|.|::               :|.:......:.|.:....
  Rat    12 WKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPG 76

  Fly   634 SRKVPMIKMAQPFISFTPIGPRTNPKAVSFDPRNSTEVMEKY-------------AGIMALLEK- 684
            ..::|.|:..:  |||.|    .:||:......|....:|||             .|.|....| 
  Rat    77 LTQIPQIQKTE--ISFRP----NDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGSMPSEPKE 135

  Fly   685 YGDYGHNP------RF-----GTCTA--NEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKA 736
            .|::.|..      ||     |.|:.  :|.:||..|:||:.:|:||::|||.:|         .
  Rat   136 RGEFNHERGERKVCRFKLDWLGNCSGLNDESYGYKEGKPCIIIKLNRVLGFKPKP---------P 191

  Fly   737 KIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEEKIEYIAN 801
            |.:.:|...|        |.:.:.|...:.|...:|::                  ::|:..|..
  Rat   192 KNESLETYPL--------TMKYNPNVLPVQCTGKRDED------------------KDKVGNIEY 230

  Fly   802 EGKKSFFG--------------PNDVNRIVALKIKNLKANERVHINCKMWAQNIHHRKEGYGQVS 852
            .|...|:|              |..:..::|::..||..:..:.|.||.:.:||     ||.:..
  Rat   231 FGMGGFYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTLDTEIRIECKAYGENI-----GYSEKD 290

  Fly   853 FF 854
            .|
  Rat   291 RF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 33/157 (21%)
Atp1b1NP_037245.2 Na_K_ATPase_bet 1..304 CDD:273446 67/327 (20%)
immunoglobulin-like. /evidence=ECO:0000250 191..304 24/133 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.