DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Atp4b

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_036642.2 Gene:Atp4b / 24217 RGDID:2178 Length:294 Species:Rattus norvegicus


Alignment Length:347 Identity:60/347 - (17%)
Similarity:116/347 - (33%) Gaps:131/347 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 KGCEYHFPGRTEWRRLFFNKIHGKYKLRRPSHWLY-TLVFSVLYILFVIIFSMAWF--------- 626
            |.|....   .|:|:..:|...|:...|.|:.|:: :|.::..|::...:|::..:         
  Rat     8 KSCSQRM---AEFRQYCWNPDTGQMLGRTPARWVWISLYYAAFYVVMTGLFALCIYVLMQTIDPY 69

  Fly   627 -----DFIK----------------------DDASRKVPMIKMAQPFIS-FTPIGPRTN------ 657
                 |.:|                      .:.|....:......|:: :||...:.:      
  Rat    70 TPDYQDQLKSPGVTLRPDVYGERGLQISYNISENSSWAGLTHTLHSFLAGYTPASQQDSINCSSE 134

  Fly   658 ----------PKAVSFDPRNSTEVMEKYAGIMALLEKYGDYGHNPRFGTCTANEKFGYPSGEPCV 712
                      |....|..:.:.::::..:|::                    :..||:..|:||.
  Rat   135 KYFFQETFSAPNHTKFSCKFTADMLQNCSGLV--------------------DPSFGFEEGKPCF 179

  Fly   713 FLKVNRIIGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDK---- 773
            .:|:|||:.|                          |..|.|..     |...|.:.|..|    
  Rat   180 IIKMNRIVKF--------------------------LPSNNTAP-----RVDCTFQDDPQKPRKD 213

  Fly   774 --NVLIEFHPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKM 836
              .:.::::|.....:        :.|....|||:  .|:..|.:||.|..|:..|.:|.|.||:
  Rat   214 IEPLQVQYYPPNGTFS--------LHYFPYYGKKA--QPHYSNPLVAAKFLNVPKNTQVLIVCKI 268

  Fly   837 WAQNI-----HHRKEGYGQVSF 853
            .|.::     |...|  |:|.|
  Rat   269 MADHVTFDNPHDPYE--GKVEF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 35/154 (23%)
Atp4bNP_036642.2 Na_K_ATPase_bet 2..294 CDD:273446 60/347 (17%)
immunoglobulin-like. /evidence=ECO:0000250 194..294 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.