DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Atp1b2

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_036639.2 Gene:Atp1b2 / 24214 RGDID:2171 Length:290 Species:Rattus norvegicus


Alignment Length:317 Identity:70/317 - (22%)
Similarity:119/317 - (37%) Gaps:95/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   583 EWRRLFFNKIHGKYKLRRPSHWLYTLVF-SVLYILFVIIFSMAWFDFIKDDASRKVPMI--KMAQ 644
            ||:...:|....::..|..:.|.:.|:| .|.|.....:|::..:..:: ..|...|..  ::|.
  Rat    16 EWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQ-TVSDHTPKYQDRLAT 79

  Fly   645 PFISFTPIGPRTNPKAVSFD---PRNSTEVMEKYA-GIMALLEKYGD--------------YGHN 691
            |       |....||..:.|   ..:.||..:::. .:...||.|.|              |...
  Rat    80 P-------GLMIRPKTENLDVIVNISDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQ 137

  Fly   692 P-----------------RFGTCTA---NEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKA 736
            |                 :.|.|:.   ...:||.:|:||||:|:||:|.|    |..:::.:. 
  Rat   138 PDNGVLNYPKRACQFNRTQLGNCSGIGDPTHYGYSTGQPCVFIKMNRVINF----YAGANQSMN- 197

  Fly   737 KIDEVEFTALKRLLENTTTEEGHLNRTWITC--RSDKDKNVLIEFHPEPAIRTEYTDIEEKIEYI 799
                                        :||  :.|:|...|..|...||    ..:|:  :.|.
  Rat   198 ----------------------------VTCVGKKDEDAENLGHFIMFPA----NGNID--LMYF 228

  Fly   800 ANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI---HHRKEGYGQVSF 853
            ...|||  |..|....:||:|..|:..|..|::.|::.|.||   ..|.:..|:|:|
  Rat   229 PYYGKK--FHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 39/148 (26%)
Atp1b2NP_036639.2 Na_K_ATPase_bet 2..289 CDD:273446 70/317 (22%)
immunoglobulin-like. /evidence=ECO:0000250 193..290 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.