DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and nkb-2

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_501958.1 Gene:nkb-2 / 177950 WormBaseID:WBGene00008074 Length:374 Species:Caenorhabditis elegans


Alignment Length:331 Identity:68/331 - (20%)
Similarity:118/331 - (35%) Gaps:122/331 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 PSHWLYTLVFSVLYILF----VIIFSMAWFDFIKDDASRKVPMIKMAQPFISFTPIGPRTNPKAV 661
            |..::::.:|  |::|:    ::..::.||:|.:.|  |:.|:......|:...|        .|
 Worm   100 PYGYIFSFIF--LFVLWGLATMLAIALVWFNFSRLD--RQYPIYFGDGSFLGGAP--------KV 152

  Fly   662 SFDP----------RNS------------------TEVMEKYAGIMA---------------LLE 683
            ||||          :|:                  .:|::||:|.:.               ..|
 Worm   153 SFDPNPRQFLEDGTKNAMSWNIYEFSTYVNYLIRYKQVLKKYSGGIGKQKVKKEEMCKNQTMTRE 217

  Fly   684 KYGDYGHNPRFGTCTAN-----EKFGYPSGEPCVFLKVNRIIGF-------KTEPYINSDEL--- 733
            ....:.....||.||.:     ..|||..|:||:.||:|:|:|:       |.:....|.:|   
 Worm   218 NACKFDRLTDFGECTLSLDNLERGFGYSKGQPCIMLKLNKIVGWVPNLSPSKNKTKCPSGDLCCG 282

  Fly   734 --VKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEEKI 796
              :|.|                             |.|:.|  |..|:.|:..|.|.|      .
 Worm   283 QGIKFK-----------------------------CTSNAD--VKFEYFPKTGIPTCY------F 310

  Fly   797 EYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNIHHRKEG-YGQVSFFVLLATN 860
            .| ||:|  .:..|..:     :|:.|:..|....|.|.....:::....| ..:..|.:|:..|
 Worm   311 PY-ANQG--GYEQPYQM-----VKLTNITVNRETTIECAPEDSSLNTLASGKTNEARFHILMTKN 367

  Fly   861 ENRERV 866
            ...|.|
 Worm   368 RPVETV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 35/155 (23%)
nkb-2NP_501958.1 Na_K-ATPase 102..340 CDD:298651 60/294 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5606
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.