DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Atp4b

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_033854.1 Gene:Atp4b / 11945 MGIID:88114 Length:294 Species:Mus musculus


Alignment Length:339 Identity:69/339 - (20%)
Similarity:120/339 - (35%) Gaps:115/339 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 KGCEYHFPGRTEWRRLFFNKIHGKYKLRRPSHWLY-TLVFSVLYILFVIIFSMAWF--------- 626
            |.|....   .|:|...:|...|:...|.|:.|:: :|.::..|::...:|::..:         
Mouse     8 KSCSQRM---AEFRHYCWNPDTGQMLGRTPARWVWISLYYAGFYVVMTGLFALCIYVLMQTIDPY 69

  Fly   627 -----DFIK----------------------DDASRKVPMIKMAQPFIS-FTPIGPR-----TNP 658
                 |.:|                      .:.|....:......|:: :||...:     |:.
Mouse    70 TPDYQDQLKSPGVTLRPDVYGERGLKISYNVSENSSWAGLTHTLHSFLAGYTPASQQDSINCTSE 134

  Fly   659 K---AVSFDPRNSTEVMEKYAGIMALLEKYGDYGHNPRFGTCT--ANEKFGYPSGEPCVFLKVNR 718
            |   ..||...|.|:...|:...|              ...|:  |:..||:..|:||..:|:||
Mouse   135 KYFFQESFAAPNHTKFSCKFTADM--------------LQNCSGLADPSFGFEEGKPCFIIKMNR 185

  Fly   719 IIGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSD-----KDKNVL-I 777
            |:.|                          |..|.|..     |...|.:.|     ||...| :
Mouse   186 IVKF--------------------------LPSNNTAP-----RVDCTFQDDPQKPRKDTEPLQV 219

  Fly   778 EFHPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI- 841
            |::|.....:        :.|....|||:  .|:..|.:||.|:.|:..|.:|.|.||:.|.:: 
Mouse   220 EYYPPNGTFS--------LHYFPYYGKKA--QPHYSNPLVAAKLLNVPKNMQVSIVCKILADHVT 274

  Fly   842 -HHRKEGY-GQVSF 853
             ::..:.| |:|.|
Mouse   275 FNNPHDPYEGKVEF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 37/151 (25%)
Atp4bNP_033854.1 Na_K_ATPase_bet 2..294 CDD:273446 69/339 (20%)
immunoglobulin-like. /evidence=ECO:0000250 194..294 29/110 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.