DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Atp1b1

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_033851.1 Gene:Atp1b1 / 11931 MGIID:88108 Length:304 Species:Mus musculus


Alignment Length:325 Identity:65/325 - (20%)
Similarity:119/325 - (36%) Gaps:98/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 WRRLFFNKIHGKYKLRRPSHWLYTLVFSVLY---------------ILFVIIFSMAWFDFIKDDA 633
            |::..:|....::..|....|...|:|.|::               :|.:......:.|.:....
Mouse    12 WKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPG 76

  Fly   634 SRKVPMIKMAQPFISFTPIGPRTNPKAVSFDPRNSTEVMEKY--------------AGIMALLEK 684
            ..::|.|:..:  |||.|    .:||:......|....:|||              ..:.:..::
Mouse    77 LTQIPQIQKTE--ISFRP----NDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKE 135

  Fly   685 YGDYGHNP------RF-----GTCTA--NEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKA 736
            .||..|..      ||     |.|:.  ::.:||..|:||:.:|:||::|||.:|         .
Mouse   136 RGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKP---------P 191

  Fly   737 KIDEVE-FTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEEKIEYIA 800
            |.:.:| :..:.:...|....:       .|.:.|:||                 |....|||..
Mouse   192 KNESLETYPLMMKYNPNVLPVQ-------CTGKRDEDK-----------------DKVGNIEYFG 232

  Fly   801 NEGKKSF-------FG----PNDVNRIVALKIKNLKANERVHINCKMWAQNIHHRKEGYGQVSFF 854
            ..|...|       :|    |..:..::|::..||..:..:.:.||.:.:||     ||.:...|
Mouse   233 MGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENI-----GYSEKDRF 292

  Fly   855  854
            Mouse   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 34/155 (22%)
Atp1b1NP_033851.1 Na_K_ATPase_bet 1..304 CDD:273446 65/325 (20%)
immunoglobulin-like. /evidence=ECO:0000250 191..304 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5606
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.