DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and atp1b2b

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_571913.1 Gene:atp1b2b / 114457 ZFINID:ZDB-GENE-010718-1 Length:292 Species:Danio rerio


Alignment Length:330 Identity:69/330 - (20%)
Similarity:120/330 - (36%) Gaps:114/330 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 WRRLFFNKIHGKYKLRRPSHW-LYTLVFSVLYILFVIIFSMAWFDFIKD-DASRKVPMIKMAQPF 646
            |:..|:|....::..|..|.| |..|.:...||....:|::..:..::. |..|.....:::.|.
Zfish     9 WKEFFWNPRTREFCGRTASSWGLILLFYLAFYIFLAGLFTLTMYVMLQTLDDHRPTYQDRLSTPG 73

  Fly   647 ISFTPIGPRTNPKAVSFDPRNSTEVMEKYAGIMAL---LEKYGDYGHNPRFGTCTANEKF----- 703
            :...|.|.:..   ::: ....||..|:|  :.||   |..|.|.....:...|..::.|     
Zfish    74 MMIRPKGEQLE---IAY-TTEYTETWERY--VQALNNFLSPYNDTVQTQKNYECKPDQFFIQEDS 132

  Fly   704 -----------------------------GYPSGEPCVFLKVNRIIGFKTEPYINSDELVKAKID 739
                                         ||..|:||:.:|:||:||           |:.||..
Zfish   133 GGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIG-----------LLPAKDG 186

  Fly   740 EVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEEKIEYIANEGK 804
            :..:                     :||.:.|.|          ..:.|:||..:|:      |:
Zfish   187 QPPY---------------------VTCGAKKYK----------VGKDEWTDDSDKL------GE 214

  Fly   805 KSFFGPN---------------DVN---RIVALKIKNLKANERVHINCKMWAQNI---HHRKEGY 848
            .:::.||               .||   .:||:|..|:..||.|::.||:.:.||   ..|.:..
Zfish   215 LAYYPPNGTFNLMYYPYYGKKAQVNYSQPLVAVKFLNITRNEDVNVECKINSNNIPEGSERDKFA 279

  Fly   849 GQVSF 853
            |:|||
Zfish   280 GRVSF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 39/198 (20%)
atp1b2bNP_571913.1 Na_K-ATPase 7..283 CDD:278704 66/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.