DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and atp1b4

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:XP_002931848.1 Gene:atp1b4 / 100490400 XenbaseID:XB-GENE-975977 Length:317 Species:Xenopus tropicalis


Alignment Length:387 Identity:77/387 - (19%)
Similarity:136/387 - (35%) Gaps:135/387 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 GTDVIYMHP---IKTDRKKLNKLIVDPPPDNGPYKMPTKEDRRTYYKGCEYHFPGRTEW----RR 586
            |.||.|:|.   |...|::        .|:. |.:...:|.::|:           .||    :.
 Frog     9 GEDVKYLHSADNISDGRQQ--------HPEE-PGETNQEEQKKTW-----------GEWIQDMKH 53

  Fly   587 LFFNKIHGKYKLRRPSHW-LYTLVFSVLYILFVIIFSMAWFDFIKDDASRKVPMIKMAQPFIS-- 648
            ..:|....:...|....| |..|.:||||.....:|::..:.           ::....|::.  
 Frog    54 FIWNPEKKEVLGRDKRSWALILLFYSVLYCFLAGMFALCMYG-----------LLATISPYVPTY 107

  Fly   649 ----FTP---IGPRTNPKAVSFDPRNSTE--VMEKYA-GIMALLEKYGDYGHNPRFGTCTANE-- 701
                |.|   |.|:.|....:|   ||:|  ....|| .:...||.|.|.....:...||..:  
 Frog   108 RERVFPPGLTIRPQANALYFAF---NSSERSTWSSYAESLNTFLEDYNDETQKEKNLVCTPGKYF 169

  Fly   702 -----------------------------KFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKAK 737
                                         .||:..|:||:.:|:|||:|:               
 Frog   170 LQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILGY--------------- 219

  Fly   738 IDEVEFTALKRLLENTTTEEGHLNRTWITCRSDK-DKNVL--IEFHPEPAIRTEYTDIEEKIEYI 799
                              :.|.....::||...| |.:.|  |.|:|.......|.....|:.::
 Frog   220 ------------------QAGSGIPIYVTCEVLKADMSYLGPISFYPSDKFDLMYYPYYGKLTHV 266

  Fly   800 ANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI--HHRKEGY-GQVSFFVLLA 858
                       |..:.::|::...:|.||.|::.||:..::|  .|.|:.: |:|:|.:.:|
 Frog   267 -----------NYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHEKDRFLGRVAFTLHIA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 32/148 (22%)
atp1b4XP_002931848.1 Na_K-ATPase 49..310 CDD:366001 61/318 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.