DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and atp1b4

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:XP_002664470.2 Gene:atp1b4 / 100037383 ZFINID:ZDB-GENE-070412-1 Length:347 Species:Danio rerio


Alignment Length:441 Identity:80/441 - (18%)
Similarity:135/441 - (30%) Gaps:171/441 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 GHSDDRVREIGVNTKKLPKIIIPPIAE-MHVHKNGKLRDIGTSTDKPFWPIDDGTDVIYMHPIKT 540
            |.::|.:.|..|:..:...:....:|| |.|.:.|                     ::...|::.
Zfish     8 GGAEDLLLEDKVSKLRAGSLHKHELAEAMEVEQEG---------------------LVEHQPLEQ 51

  Fly   541 DRKKLNKLIVDPPPDNGPYKMPTKEDRRTYYKGCE-YHFPGRTEWRRLFFNKIHGKYKLRRPSHW 604
            |.....|....|.|....::  ..:|.:||....| ..|.||:           ||       .|
Zfish    52 DDLNFEKWKPKPKPKRTLHE--KIDDLKTYLWNAETKEFMGRS-----------GK-------SW 96

  Fly   605 -LYTLVFSVLYILFVIIFS-----MAWFDFIKDDASRKVPMIKMAQPFISFTPIGP----RTNPK 659
             |..|.::.|||....:|:     :.|                      |.:|..|    |..|.
Zfish    97 SLILLFYAALYIFLAAMFAGCMCCLMW----------------------SISPYAPTYNDRVMPP 139

  Fly   660 AVSFDPRNST-------------EVMEKYAGIM-ALLEKYGDYGHNPR----------------- 693
            .::..|...|             ....:||..: |.|:.|.|...:.|                 
Zfish   140 GMTMFPHVDTAHGFDIAFNASDRSSWRRYAKTLEAHLKPYDDGLQSRRNIACKGNAYFMQEDLEE 204

  Fly   694 -------------FGTCTA--NEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKAKIDEVEF 743
                         .|.|:.  ::.|||..|.||:.:|:|||:|:.                    
Zfish   205 SAERKACQFNRSSLGACSGLQDKDFGYSKGRPCILVKMNRILGYL-------------------- 249

  Fly   744 TALKRLLENTTTEEGHLNRTWITCRSDKDKNVL---IEFHPEPAIRTEYTDIEEKIEYIANEGKK 805
                         .|......:||...|....:   ::|.|.|.....|.....|:.::      
Zfish   250 -------------PGQGTPVNVTCGLKKGSTEVLGEVKFFPNPNFDLRYYPYYGKLRHV------ 295

  Fly   806 SFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNIHH---RKEGYGQVSF 853
                 |..:.:||::..|::.:..:||.||:..:.|.:   .....|.|||
Zfish   296 -----NYSSPLVAVQFLNVQHDTPLHIQCKLNGKGIINDSPTDRFLGSVSF 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 29/149 (19%)
atp1b4XP_002664470.2 Na_K-ATPase 71..340 CDD:278704 63/354 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.