DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33245 and kin-10

DIOPT Version :9

Sequence 1:NP_996423.2 Gene:Ste:CG33245 / 2768906 FlyBaseID:FBgn0053245 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001379151.1 Gene:kin-10 / 172610 WormBaseID:WBGene00002196 Length:235 Species:Caenorhabditis elegans


Alignment Length:176 Identity:73/176 - (41%)
Similarity:104/176 - (59%) Gaps:15/176 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLE----YFSEILDVI--LKPVID-- 57
            ||||:  ..|||.||.|::||:|.|.|..:|:||.||..||.    .:.:.||:|  |:|..|  
 Worm     1 MSSSE--EVSWITWFCGLRGNEFFCEVDEEYIQDRFNLTGLNEQVPKYRQALDMILDLEPEDDIE 63

  Fly    58 ---SSSGLLYGDEKKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCDRQNTLPVGLSAVW 119
               :::.|:....:..||:||||||.:.||:..|..|:...|||.||.:.|:.|..||:|||.|.
 Worm    64 DNATNTDLVEQAAEMLYGLIHARYILTNRGISQMVEKWRDHDFGVCPRVYCENQPMLPIGLSDVP 128

  Fly   120 GKSTVKIHCPRCKSNFHPKSD--TQLDGAMFGPSFPDIFFSMLPNL 163
            |::.||::||||...|.|:|.  ...||:.||..||.:.|.:.|:|
 Worm   129 GEAMVKLYCPRCNDVFVPRSSRHQHTDGSYFGTGFPHMLFFVHPDL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33245NP_996423.2 CK_II_beta 11..166 CDD:198153 68/166 (41%)
kin-10NP_001379151.1 CK_II_beta 8..191 CDD:198153 69/167 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.