DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33239 and CG40635

DIOPT Version :10

Sequence 1:NP_996429.2 Gene:Ste:CG33239 / 2768901 FlyBaseID:FBgn0053239 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001104166.2 Gene:CG40635 / 5740827 FlyBaseID:FBgn0085506 Length:88 Species:Drosophila melanogaster


Alignment Length:127 Identity:24/127 - (18%)
Similarity:38/127 - (29%) Gaps:68/127 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DNFLNLVDVSKYENSDILLDQQGFEGTADIRKRTMNGANFYIP---SKSSSQSLVESWLFWQKSV 226
            |..|::::.||..||.:::|..          ||..|:..||.   ||...||            
  Fly    94 DELLSVLEKSKETNSLVVVDFY----------RTACGSCKYIEQGFSKLCKQS------------ 136

  Fly   227 YITDPDLVKMFCLRGDYSCDYVPYSLVTGWEWIYGDQKNPPIMIQMDGETGGNKEKVLEKYN 288
                                              |||:.|.|.:         |..|:::|:
  Fly   137 ----------------------------------GDQEAPVIFL---------KHNVVDEYD 155

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity