DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33242 and Ste:CG33243

DIOPT Version :9

Sequence 1:NP_996426.2 Gene:Ste:CG33242 / 2768898 FlyBaseID:FBgn0053242 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_996425.2 Gene:Ste:CG33243 / 2768897 FlyBaseID:FBgn0053243 Length:172 Species:Drosophila melanogaster


Alignment Length:172 Identity:152/172 - (88%)
Similarity:155/172 - (90%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSTTTAAGSIG-SSGSRATSSSCRVPTDYVQDTFNQMGLEYFSEILDVILKPVIDSSSGLLYG 64
            ||||....:..|. ..|.:.....|||||||||||||||||||||||||||||||||||||||||
  Fly     1 MSSSQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLEYFSEILDVILKPVIDSSSGLLYG 65

  Fly    65 DEKKWYGMIHARYIRSERGLIAMHRKYMRGDFGSCPNISCDRQNTLPVGLSAVWGKSTVKIHCPR 129
            |||||||||||||||||||||||||||:||||||||||||.||||||||||||||||||||||||
  Fly    66 DEKKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCYRQNTLPVGLSAVWGKSTVKIHCPR 130

  Fly   130 CKSNFHPKSDTQLDGAMFGPSFPDIFFSMLPNLTSPLDDPRT 171
            ||||||||||||||||||||||||||||||||||||||||||
  Fly   131 CKSNFHPKSDTQLDGAMFGPSFPDIFFSMLPNLTSPLDDPRT 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33242NP_996426.2 CK_II_beta 24..165 CDD:198153 138/140 (99%)
Ste:CG33243NP_996425.2 CK_II_beta 11..166 CDD:198153 140/154 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448585
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005928
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.