DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33242 and CkIIbeta

DIOPT Version :10

Sequence 1:NP_996426.2 Gene:Ste:CG33242 / 2768898 FlyBaseID:FBgn0053242 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_061515279.1 Gene:CkIIbeta / 1278254 VectorBaseID:AGAMI1_013621 Length:229 Species:Anopheles gambiae


Alignment Length:43 Identity:8/43 - (18%)
Similarity:20/43 - (46%) Gaps:9/43 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LGALLYVVDMSLIFI-------SREKEV--SDSYAVTTTTTHY 279
            :|.|:|..:..::..       :|.:.:  ..:|:|.|.|.::
Mosquito    59 IGKLIYQAEQRIVQAEHYGIPHARPEYLPPDTAYSVRTKTQNF 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33242NP_996426.2 CK_II_beta 24..165 CDD:198153
CkIIbetaXP_061515279.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.