DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33243 and CKB2

DIOPT Version :9

Sequence 1:NP_996425.2 Gene:Ste:CG33243 / 2768897 FlyBaseID:FBgn0053243 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_014682.1 Gene:CKB2 / 854204 SGDID:S000005565 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:176 Identity:70/176 - (39%)
Similarity:97/176 - (55%) Gaps:14/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLE----YFSEIL--------DVILKP 54
            |.|......|||.|||.||:::.|.|..:|:.|.||.|.|:    .||.::        |.||:.
Yeast    29 SDSSEYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSILEN 93

  Fly    55 VIDSSSGLLYGDEKKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCYRQNTLPVGLSAVW 119
            :..:....|..|.:|.||:||||||.:.:||..|:.||...|||.||.:.|..|..|||||..:.
Yeast    94 MTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPVGLHDIP 158

  Fly   120 GKSTVKIHCPRCKSNFHPKSD--TQLDGAMFGPSFPDIFFSMLPNL 163
            |...||::||.|:..:.|||.  :.:|||.||.|||.:|....|::
Yeast   159 GIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPDM 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33243NP_996425.2 CK_II_beta 11..166 CDD:198153 68/167 (41%)
CKB2NP_014682.1 SKB2 12..258 CDD:227374 70/176 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343661
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.