DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33243 and CkIIbeta2

DIOPT Version :9

Sequence 1:NP_996425.2 Gene:Ste:CG33243 / 2768897 FlyBaseID:FBgn0053243 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster


Alignment Length:177 Identity:66/177 - (37%)
Similarity:101/177 - (57%) Gaps:25/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFN----QMGLEYFSEILDVIL------------ 52
            :.::.||||.||...:||:|.|.|..:|:||.||    ...::.:...|:|||            
  Fly     2 TDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASEDPA 66

  Fly    53 KPVIDSSSGLLYGDEKKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCYRQNTLPVGLSA 117
            :|.:::|:       :|.||:||||:|.:.||:..|..||.:|:||:||...|:.|..||:|||.
  Fly    67 EPELEASA-------EKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSD 124

  Fly   118 VWGKSTVKIHCPRCKSNFHPKSD--TQLDGAMFGPSFPDIFFSMLPN 162
            ..|:..|:|:||:|...:.||:.  :.||||.||..||.:||...|:
  Fly   125 NPGEDMVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33243NP_996425.2 CK_II_beta 11..166 CDD:198153 64/170 (38%)
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 64/170 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.