DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33243 and ckb1

DIOPT Version :9

Sequence 1:NP_996425.2 Gene:Ste:CG33243 / 2768897 FlyBaseID:FBgn0053243 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001342935.1 Gene:ckb1 / 2542564 PomBaseID:SPAC1851.03 Length:231 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:79/182 - (43%)
Similarity:108/182 - (59%) Gaps:13/182 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSQNNNSS-WIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLE----YFSEILDVILKPVIDSSSG 61
            |.|::::|. |:|||||:|||:|.|.|..|::||.||..||.    ::|:.||:|| .|:|....
pombe     6 SESESDDSQYWVDWFLGLKGNEFFCEVDEDFIQDRFNLTGLSHEVPHYSQSLDLIL-DVLDPDLP 69

  Fly    62 LLYGDE-----KKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCYRQNTLPVGLSAVWGK 121
            ....||     :..||:||||||.:.:||..|..||.:.|||.||.:.|..|..||||||.:...
pombe    70 EEVQDEVEASARHLYGLIHARYILTAQGLYKMLEKYKKCDFGHCPRVLCNGQPMLPVGLSDIAHT 134

  Fly   122 STVKIHCPRCKSNFHPKSD--TQLDGAMFGPSFPDIFFSMLPNLTSPLDDPR 171
            .:||::||||:..:.|||.  ..:|||.||.|||.:.|.:.|.|..|....|
pombe   135 KSVKLYCPRCEDVYTPKSQRHASIDGAYFGTSFPHMLFQVYPELAVPKSQER 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33243NP_996425.2 CK_II_beta 11..166 CDD:198153 74/165 (45%)
ckb1NP_001342935.1 SKB2 16..231 CDD:227374 76/172 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.