DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42271 and Y37D8A.25

DIOPT Version :10

Sequence 1:NP_996434.2 Gene:CG42271 / 2768892 FlyBaseID:FBgn0259166 Length:1280 Species:Drosophila melanogaster
Sequence 2:NP_001022833.1 Gene:Y37D8A.25 / 3565405 WormBaseID:WBGene00012560 Length:141 Species:Caenorhabditis elegans


Alignment Length:140 Identity:36/140 - (25%)
Similarity:61/140 - (43%) Gaps:12/140 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFNKPELNSLASNPATRFDKEGLLIITDRQEGFLWRSSEVRVERWCKLRGNLLF-YLKDKDPKS 64
            |..|...|..|.|:|.......|.|.:   |:.|.||:.      |..|:.|:|| |.|.::..|
 Worm     1 MLANANSLFRLGSDPTFERRFSGPLQL---QQDFQWRAG------WGVLKANMLFVYNKTEEETS 56

  Fly    65 AVAG-LLVLENCRARIQNEERDSEGYVFDLDFKDSPSERFITRSSAERLA-WVQCIEHASSEKLN 127
            |... ||::|:|...:.:|.:..:.:.|::.||.:.........|.:.|. ||..:..:..:.:.
 Worm    57 APPFLLLIIEDCFIELCDENKIGKDFTFEIKFKSTARSFIFAADSFKSLGRWVSLLTISPIDYIQ 121

  Fly   128 ALIRQLKEQI 137
            ...:...|||
 Worm   122 LSKQSFHEQI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42271NP_996434.2 PH_INPP4A_INPP4B 1..145 CDD:270091 36/140 (26%)
C2 201..318 CDD:472691
Y37D8A.25NP_001022833.1 PH-like 31..133 CDD:473070 27/107 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.