DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and STOML1

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_004800.2 Gene:STOML1 / 9399 HGNCID:14560 Length:398 Species:Homo sapiens


Alignment Length:268 Identity:85/268 - (31%)
Similarity:143/268 - (53%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLR 136
            |.:.:..|::::|||||.:...|:|..|||.::||:||:|:  .:|||:..:||.:|.:..||||
Human    58 LISFLGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRT--PQGPGMVLLLPFIDSFQRVDLR 120

  Fly   137 TVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSE 201
            |.:|:|||.::.|||...::|.|.|.:||.||:.:|:.|.:.:.:|.:.|...:...|..|.|.|
Human   121 TRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLRE 185

  Fly   202 LLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAE-- 264
            :..|:..||..:.:.:::.|..||::|:|||:   ::...||....:.|....::..:.:|..  
Human   186 IQMEKLKISDQLLLEINDVTRAWGLEVDRVEL---AVEAVLQPPQDSPAGPNLDSTLQQLALHFL 247

  Fly   265 -GEMKS------SRALREASEIIS-ASPSALQLRYLQTLSSISTEKNSTIIFPLPMELLT---PF 318
             |.|.|      |....:..|::| ..|.|.|      :.:.|:.|.     ||...|||   ||
Human   248 GGSMNSMAGGAPSPGPADTVEMVSEVEPPAPQ------VGARSSPKQ-----PLAEGLLTALQPF 301

  Fly   319 LNTQAHSQ 326
            |:....||
Human   302 LSEALVSQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 53/146 (36%)
SPFH_SLP-4 112..319 CDD:259813 64/219 (29%)
STOML1NP_004800.2 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000255, ECO:0000269|PubMed:19696025 6..10
PHB 77..217 CDD:214581 52/141 (37%)
SPFH_SLP-1 94..224 CDD:259814 46/134 (34%)
SCP2 304..395 CDD:280250 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.