DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and PHB2

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_011747.2 Gene:PHB2 / 853146 SGDID:S000003463 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:54/227 - (23%)
Similarity:96/227 - (42%) Gaps:42/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RAVIFRMGRLRSGGAR--GPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLS----KDSVTVTVDA 159
            ||:::  .|:....:|  ..|..|:.|.:|.....|:|     ..|:.|.|    ||...|.:..
Yeast    66 RAIVY--SRIHGVSSRIFNEGTHFIFPWLDTPIIYDVR-----AKPRNVASLTGTKDLQMVNITC 123

  Fly   160 VVYYRISDP----LKAVIQVYNYSHSTSLLAA---TTLRNVLGTRNLSELLTERETISHTMQMSL 217
            .|   :|.|    |..:.:.....:...:|.:   ..|:.|:...|.|:|:|:||.:|..::.:|
Yeast   124 RV---LSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREKVSRLIRENL 185

  Fly   218 DEATDPWGVKVE---------------RVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEM 267
            ......:.:.::               .||.|.::...| |||.....:|.:|.:..|:.|:||.
Yeast   186 VRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDA-QRAAFVVDKARQEKQGMVVRAQGEA 249

  Fly   268 KSSRALREASEIISASPSALQLRYLQTLSSIS 299
            ||:..:.||   |..|...::|:.|.|...|:
Yeast   250 KSAELIGEA---IKKSRDYVELKRLDTARDIA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 34/165 (21%)
SPFH_SLP-4 112..319 CDD:259813 51/216 (24%)
PHB2NP_011747.2 SPFH_prohibitin 58..252 CDD:259799 45/196 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.