DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and AT5G51570

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_199970.1 Gene:AT5G51570 / 835231 AraportID:AT5G51570 Length:292 Species:Arabidopsis thaliana


Alignment Length:261 Identity:54/261 - (20%)
Similarity:97/261 - (37%) Gaps:70/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VIFRMGRLRSGGARGPGVFFVLPCVDDYYP--VDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRI 165
            |:.|.||...  ...||..|..|....:..  :..|..|.|| ..|..:||:|.|.:...:.||:
plant    19 VVERWGRFEH--IAEPGCHFFNPLAGQWLAGVLSTRIKSLDV-KIETKTKDNVFVQLVCSIQYRV 80

  Fly   166 ------------SDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLD 218
                        .:| |..||.|.:.         .:|.::....|..|..::..::.::...|:
plant    81 VKASADDAFYELQNP-KEQIQAYVFD---------VVRALVPMMTLDALFEQKGEVAKSVLEELE 135

  Fly   219 EATDPWGVKVERVEIKDVSLPTALQRAM---------------AAEAE-------AAREARAKVI 261
            :....:|..:|.:.:.|:....::::||               ..|||       |..||.||.:
plant   136 KVMGAYGYSIEHILMVDIIPDPSVRKAMNEINAAQRLQLASVYKGEAEKILQVKRAEAEAEAKYL 200

  Fly   262 AAEGEMKSSRA----LRE-------------ASEIISASPSALQLRYLQTLSSI-STEKNSTIIF 308
            ...|..:..:|    |||             |.|::..   .:..:|..|:..: ::.||:|:..
plant   201 GGVGVARQRQAITDGLRENILNFSDKVEGTSAKEVMDL---IMITQYFDTIRDLGNSSKNTTVFL 262

  Fly   309 P 309
            |
plant   263 P 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 31/149 (21%)
SPFH_SLP-4 112..319 CDD:259813 50/252 (20%)
AT5G51570NP_199970.1 SPFH_like_u4 11..280 CDD:259805 54/261 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.