DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and AT4G27585

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_567778.1 Gene:AT4G27585 / 828868 AraportID:AT4G27585 Length:411 Species:Arabidopsis thaliana


Alignment Length:426 Identity:103/426 - (24%)
Similarity:168/426 - (39%) Gaps:116/426 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QHAVHIPPP-----------------PSLPYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISV 89
            |.||..|||                 ||..:|                          ||.|.:.
plant    23 QSAVTSPPPIFSAAASTVRQFTSAGYPSNSFQ--------------------------LTPPTNW 61

  Fly    90 FICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDY-YPVDLRTVSFDVPPQEVLSKDSV 153
            .|  ::|.|.:..||.|.|:..:  ....|:.|::|.||.. |...|:..:..:|.|..::||:|
plant    62 GI--RIVPERKAFVIERFGKYAT--TLPSGIHFLIPFVDRIAYVHSLKEEAIPIPNQTAITKDNV 122

  Fly   154 TVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLD 218
            ::.:|.|:|.:|.||..|...|.:..::...||.||:|:.||...|.:...||:|::..:..:::
plant   123 SIHIDGVLYVKIVDPKLASYGVESPIYAVVQLAQTTMRSELGKITLDKTFEERDTLNEKIVEAIN 187

  Fly   219 EATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKS-------------- 269
            .|...||::..|.||:|:..|..::.||..:|||.|:.||:::.:|||.:|              
plant   188 VAAKDWGLQCLRYEIRDIMPPHGVRAAMEMQAEAERKKRAQILESEGERQSHINIADGKKSSVIL 252

  Fly   270 ----------SRALREASEIISASPS-------------------ALQLR----YLQTLSSISTE 301
                      :||..||..|::.:.:                   |..||    |:....:|:  
plant   253 ASEAAKMDQVNRAQGEAEAILARAQATAKGLVLLSQSLKETGGVEAASLRVAEQYITAFGNIA-- 315

  Fly   302 KNSTIIFPLPMELLTPFLNTQAHSQQLQLQHQQQLQQQQQQHQHQQQQHPAAPGTPL-------H 359
            |..||:. ||.....|   ....:|.|.:.....:....:.||..|    |...|.|       .
plant   316 KEGTIML-LPSGASNP---ASMIAQALTMYKSLVINGPSKDHQETQ----ALDETDLEELEDMGE 372

  Fly   360 RHPHQHHQXRSMSVL----QPYLEALHRCELQRQQK 391
            :|..:... ||.|:.    :|......|..||.:.|
plant   373 KHISEGSNNRSGSISFDTEKPGHTGEPRFSLQNRNK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 44/147 (30%)
SPFH_SLP-4 112..319 CDD:259813 67/254 (26%)
AT4G27585NP_567778.1 HflC 62..330 CDD:223407 73/274 (27%)
SPFH_paraslipin 99..208 CDD:259811 33/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.