DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and stom

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_017208322.1 Gene:stom / 81534 ZFINID:ZDB-GENE-980526-486 Length:305 Species:Danio rerio


Alignment Length:264 Identity:165/264 - (62%)
Similarity:219/264 - (82%) Gaps:1/264 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QGLKTSENDDMGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGGARGPGV 120
            |.|:.::: |:|....:..:.|:|:.:||.|:|:::|.|:|.|||||:|||:||:..|||:|||:
Zfish    41 QALENTDS-DIGLCGWILVIFSILLTLLTLPLSIWMCIKIVKEYERAIIFRLGRILRGGAKGPGL 104

  Fly   121 FFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLL 185
            ||:|||.|.:..||:||::||:||||||:||||||:||.|||||:.:...||..:.|...:|.||
Zfish   105 FFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLL 169

  Fly   186 AATTLRNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEA 250
            |.|||||||||:||:|:|::||.|:|:||.:||:|||.||:||||||||||.||..|||||||||
Zfish   170 AQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDDATDDWGIKVERVEIKDVKLPLQLQRAMAAEA 234

  Fly   251 EAAREARAKVIAAEGEMKSSRALREASEIISASPSALQLRYLQTLSSISTEKNSTIIFPLPMELL 315
            ||:||||||||||||||.:||||:|||.:|:.|||||||||||||::|:.|||||||||||::::
Zfish   235 EASREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPIDMM 299

  Fly   316 TPFL 319
            ..||
Zfish   300 QSFL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 93/146 (64%)
SPFH_SLP-4 112..319 CDD:259813 140/206 (68%)
stomXP_017208322.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.680

Return to query results.
Submit another query.