DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and stoml1

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001039193.1 Gene:stoml1 / 734047 XenbaseID:XB-GENE-990189 Length:361 Species:Xenopus tropicalis


Alignment Length:200 Identity:70/200 - (35%)
Similarity:117/200 - (58%) Gaps:14/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HIPPPPSLPYQGLKTSENDD--MGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMG 108
            |:|       |..|:..:|.  |.|.....:.:|:|.:::|||:|.:...|:|.:|:|.||||:|
 Frog    18 HLP-------QSHKSVPSDTWLMWCCHTAISCLSLLFLIVTFPLSAWCFLKMVPDYQRIVIFRLG 75

  Fly   109 RLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVI 173
            |:::  |||||:..:.|.:|.:..||:||.:|.|||.:|.|:|.|.|::.|.:.:.|.||:.:|:
 Frog    76 RVQA--ARGPGLVLLFPLIDQFQRVDMRTKAFSVPPSKVKSRDGVLVSMGADIQFCICDPVLSVL 138

  Fly   174 QVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSL 238
            .|.:.:..|...|...:...||.:.|.|:..:|..|:..::..|:|...|||:.|||||:   :|
 Frog   139 SVQDLNFVTRNTAQNLMTQSLGRKYLREIQNDRARIAEHLKEDLNEQVKPWGLCVERVEL---AL 200

  Fly   239 PTALQ 243
            .:.||
 Frog   201 ESILQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 54/146 (37%)
SPFH_SLP-4 112..319 CDD:259813 46/131 (35%)
stoml1NP_001039193.1 PHB 60..198 CDD:214581 53/139 (38%)
SPFH_SLP-1 75..205 CDD:259814 47/134 (35%)
SCP2 254..357 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.