DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and zgc:112408

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001017597.1 Gene:zgc:112408 / 550260 ZFINID:ZDB-GENE-050417-63 Length:291 Species:Danio rerio


Alignment Length:258 Identity:154/258 - (59%)
Similarity:210/258 - (81%) Gaps:1/258 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ENDDMGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPC 126
            ::...|....:.|..|.|::..|||:||:.|.|||.|||||||||:||| .|||:|||:|:::||
Zfish    33 QSKSCGFCGYILTFFSCLLIFFTFPVSVWFCMKVVQEYERAVIFRLGRL-LGGAKGPGLFWIIPC 96

  Fly   127 VDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLR 191
            :|.:..|||||||||:|.||||:|||||..|||||||||.:|..::.:|.|.:::|.::|.||||
Zfish    97 MDTFRKVDLRTVSFDIPAQEVLTKDSVTTMVDAVVYYRIFNPTVSITKVENANYATQMIAQTTLR 161

  Fly   192 NVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREA 256
            |:|||::|:::|.:||.:|..|:..|..|:..||:||||||:|||.|||.|||||||||||:|:|
Zfish   162 NMLGTKSLADILKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDA 226

  Fly   257 RAKVIAAEGEMKSSRALREASEIISASPSALQLRYLQTLSSISTEKNSTIIFPLPMELLTPFL 319
            ||||||||||||:||||:||:.::|.||:||||||:|||:.|::|:|||||||:||:|::.|:
Zfish   227 RAKVIAAEGEMKASRALKEAANVMSESPAALQLRYMQTLTEIASERNSTIIFPVPMDLMSGFM 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 86/146 (59%)
SPFH_SLP-4 112..319 CDD:259813 128/206 (62%)
zgc:112408NP_001017597.1 HflC 44..290 CDD:223407 153/247 (62%)
SPFH_like 83..283 CDD:302763 126/199 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.680

Return to query results.
Submit another query.