DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and l(2)37Cc

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster


Alignment Length:223 Identity:55/223 - (24%)
Similarity:97/223 - (43%) Gaps:33/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RAVIFRMGRLRSGGAR----GPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVL--SKDSVTVTVDA 159
            |||||.    |..|.:    |.|..|.:|.|......|:|:...:||   |:  |||...|.:..
  Fly    35 RAVIFD----RFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVP---VITGSKDLQNVNITL 92

  Fly   160 VVYYR-ISDPLKAVIQVYNYSHSTSLL---AATTLRNVLGTRNLSELLTERETISHTMQMSLDEA 220
            .:.|| |.|.|..:..:....:...:|   |...|:.|:...:..||:|:||.:|..:...|...
  Fly    93 RILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVR 157

  Fly   221 TDPWGVKVERVEI------KDVSLPTALQRAMAAEAEAAR--------EARAKVIAAEGEMKSSR 271
            ...:|..::.:.:      ::.:|...:::....|||.||        :..|.:|:|||:.:::.
  Fly   158 AKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAG 222

  Fly   272 ALREASEIISASPSALQLRYLQTLSSIS 299
            .|  |.....|....::||.::....|:
  Fly   223 LL--AKSFGEAGDGLVELRRIEAAEDIA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 38/153 (25%)
SPFH_SLP-4 112..319 CDD:259813 49/212 (23%)
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 49/192 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.