DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Phb2

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster


Alignment Length:230 Identity:55/230 - (23%)
Similarity:103/230 - (44%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RAVIF-RMGRLRSGGARGPGVFFVLPCVDDYYPV--DLRTVSFDVPPQEVL----SKDSVTVTVD 158
            ||:|| |:|.::| .....|:...:|...  ||:  |:|:     .|:::.    |||...:.:.
  Fly    50 RAIIFSRLGGIQS-DIYSEGLHVRIPWFQ--YPIIYDIRS-----RPRKISSPTGSKDLQMINIS 106

  Fly   159 AVVYYRISDPLKAVIQVYNYSHS----------TSLLAATTLRNVLGTRNLSELLTERETISHTM 213
            ..|..| .|.|.     ..|.|.          ...:....|::|:...|.|:|:|:|:.:|..:
  Fly   107 LRVLSR-PDSLN-----LPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFNASQLITQRQQVSLLI 165

  Fly   214 QMSLDEATDPWGVKVERVEIKDVSL----PTALQRAMAAEAEAAR----------EARAKVIAAE 264
            :..|.|....:.:.::.|.:.::|.    ..|::....|:.||.|          |.:.|::.||
  Fly   166 RKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFVERAKQEKQQKIVQAE 230

  Fly   265 GEMKSSRALREASEIISASPSALQLRYLQTLSSIS 299
            ||.::::.|..|   :..:|:.|:||.|:...||:
  Fly   231 GEAEAAKMLGLA---VKQNPAYLKLRKLRAAQSIA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 35/158 (22%)
SPFH_SLP-4 112..319 CDD:259813 49/218 (22%)
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 46/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.