DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and stoml2

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001004808.1 Gene:stoml2 / 448051 XenbaseID:XB-GENE-1017042 Length:350 Species:Xenopus tropicalis


Alignment Length:272 Identity:79/272 - (29%)
Similarity:134/272 - (49%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDY-YPVDLRTVSFDVPPQEVLS 149
            |::..:.|  |.:.|..||.||||...  ...||:..::|.:|.. |...|:.:..:||.|..:|
 Frog    37 PMNTVVLF--VPQQEAWVIERMGRFHR--ILEPGLNVLIPILDRIRYVQSLKEIVINVPEQSAVS 97

  Fly   150 KDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQ 214
            .|:||:.:|.|:|.||.||.||...|.:..::.:.||.||:|:.||...|.::..|||:::..:.
 Frog    98 LDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLTLDKVFRERESLNANIV 162

  Fly   215 MSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKS---------- 269
            .::::|:|.||:|..|.||||:.:|..::.||..:.||.|..||.|:.:||..:|          
 Frog   163 DAINQASDYWGIKCLRYEIKDIHVPPKVKEAMQMQVEAERRKRAMVLESEGTRESAINVAEGQKQ 227

  Fly   270 --------------SRALREASEIIS---ASPSALQL--------------------RYLQTLSS 297
                          ::|..||:.|::   |...|:::                    :|:...|.
 Frog   228 AQILASEAERAEQINKAAGEANAILAKAKARGDAIRMLAEALTQQNGNAAASLTVAEQYVLAFSK 292

  Fly   298 ISTEKNSTIIFP 309
            ::.|.| ||:.|
 Frog   293 LAKESN-TILLP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 53/147 (36%)
SPFH_SLP-4 112..319 CDD:259813 69/246 (28%)
stoml2NP_001004808.1 HflC 45..318 CDD:223407 77/262 (29%)
SPFH_paraslipin 78..188 CDD:259811 40/109 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.