DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and CG14736

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster


Alignment Length:295 Identity:134/295 - (45%)
Similarity:209/295 - (70%) Gaps:16/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QSSQHAVHIPP-------------PPSLPYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISVF 90
            :.|:|...|||             ||  |.:.::|||::.....|.:|..:...::::|||.|:.
  Fly    15 EMSKHDQKIPPKEFKRPSADGGPRPP--PSRYIQTSEDNKDSTFEKVAIGICWFLVIITFPFSMC 77

  Fly    91 ICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTV 155
            .|..:|.||.|.:|.|:||||. |.||||:.|:|||:|:.:.||:||...:|.||:||:|||||:
  Fly    78 CCLTIVPEYSRMIILRLGRLRK-GLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKDSVTI 141

  Fly   156 TVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLDEA 220
            ||:|||||.|..|:.::|||.:...:|.|::..||||::|::.|:.|||.|:.:|..:|.::...
  Fly   142 TVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGI 206

  Fly   221 TDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKSSRALREASEIISASPS 285
            |..|||:||||::.|::|||:|:|::|:||||.||||||:|.||||:|:|:||:|||:::|.:..
  Fly   207 TYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMSENKI 271

  Fly   286 ALQLRYLQTLSSISTEKNSTIIFPLPMELLTPFLN 320
            .||||:||.||||::|:...||:|:|:|::.||::
  Fly   272 TLQLRHLQILSSIASERRVRIIYPIPLEIMEPFMS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 70/146 (48%)
SPFH_SLP-4 112..319 CDD:259813 105/206 (51%)
CG14736NP_001287293.1 PHB 78..225 CDD:214581 70/147 (48%)
SPFH_like 100..305 CDD:302763 105/204 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6471
65.850

Return to query results.
Submit another query.