DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and CG14644

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster


Alignment Length:284 Identity:137/284 - (48%)
Similarity:199/284 - (70%) Gaps:1/284 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PLTPQHQSSQHAVHIPPPPS-LPYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISVFICFKVV 96
            |.||...:...:|::....| ||.:.:|||||....|.|....|:|::::||..|.|:|.|.:|:
  Fly     5 PTTPALLAQSSSVNVFHDESLLPQRNVKTSENVPPTCAEKTLFVLSMILIVLCLPWSLFCCLRVM 69

  Fly    97 SEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVV 161
            ||||||||.|:||||....|||||.|::||:||...||:||.|||:..||:|::|.||:::|.||
  Fly    70 SEYERAVILRLGRLRPKPPRGPGVIFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVV 134

  Fly   162 YYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLDEATDPWGV 226
            ||.|..|..|::|||:...:|..||.||||||.||..|.:||:.:|.:|:.::..|..:|:|||:
  Fly   135 YYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGI 199

  Fly   227 KVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKSSRALREASEIISASPSALQLRY 291
            :|||||||::.:|..|:||:|.|.||.|||:|||.||:||..:..||:||::|:..:|.||||||
  Fly   200 RVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGERDAVTALKEAADIMETNPIALQLRY 264

  Fly   292 LQTLSSISTEKNSTIIFPLPMELL 315
            ||||:||..:...:.:||.|::::
  Fly   265 LQTLNSICNDDTRSYVFPFPVDIV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 77/146 (53%)
SPFH_SLP-4 112..319 CDD:259813 101/204 (50%)
CG14644NP_649445.3 PHB 64..223 CDD:214581 82/158 (52%)
SPFH_like 89..292 CDD:302763 101/200 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473031
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6471
76.750

Return to query results.
Submit another query.