DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Stoml2

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster


Alignment Length:271 Identity:80/271 - (29%)
Similarity:137/271 - (50%) Gaps:51/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDY-YPVDLRTVSFDVPPQEVLS 149
            ||:  :|...|.:.|..|:.||||...  ...||:..::|..|.. |...|:.::.|||.|..::
  Fly    38 PIN--MCVMFVPQQEAWVVERMGRFHR--ILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAIT 98

  Fly   150 KDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQ 214
            .|:||:::|.|:|.||.||.||...|.:...:.:.||.||:|:.||..::.::..|||:::.::.
  Fly    99 SDNVTLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIV 163

  Fly   215 MSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVI-----------AAEGEMK 268
            .|:::|::.||:...|.||:|:.|||.:..||..:.||.|..||.::           .|||:.|
  Fly   164 DSINKASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRK 228

  Fly   269 S-------------SRALREASEIISASPS--------ALQLRYL--QTLSSIS----------- 299
            |             ::|..||:.||:.:.:        |..|.:|  |..:|::           
  Fly   229 SRILASEAERQEHINKASGEAAAIIAVADARARSLLAIAKSLSHLDGQNAASLTLAEQYIGAFKK 293

  Fly   300 -TEKNSTIIFP 309
             .:.|:|:|.|
  Fly   294 LAKTNNTMILP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 49/147 (33%)
SPFH_SLP-4 112..319 CDD:259813 70/245 (29%)
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 54/159 (34%)
SPFH_paraslipin 80..188 CDD:259811 37/107 (35%)
Band_7_C 266..326 CDD:292817 9/39 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473043
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.