DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Stoml1

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001292167.1 Gene:Stoml1 / 300748 RGDID:1559463 Length:398 Species:Rattus norvegicus


Alignment Length:274 Identity:84/274 - (30%)
Similarity:141/274 - (51%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLR 136
            |.:.:..|:::||||||.:...|:|..|||.::||:||:|:  .:|||:..:||.:|.:..||||
  Rat    58 LISFLGFLLLLLTFPISGWFALKIVPTYERMIVFRLGRIRN--PQGPGMVLLLPFIDSFQRVDLR 120

  Fly   137 TVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSE 201
            |.:|:|||.::.|||...::|.|.|.:||.||:.:|:.|.:.:.:|.:.|...:...|..|.|.|
  Rat   121 TRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMAVKDLNAATRMTAHNAMTKALLRRPLQE 185

  Fly   202 LLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAE-- 264
            :..|:..|...:.:.:::.|..||::|:|||:   ::...||....:.|..:.::..:.:|..  
  Rat   186 IQMEKLKIGDQLLLEINDVTRAWGLEVDRVEL---AVEAVLQPPQDSLAVPSLDSTLQQLALHFL 247

  Fly   265 -GEMKS--------SRALREASEIISASPSALQLRYLQTLSSISTEKNSTIIFPLPME-----LL 315
             |.|.|        |..|...:|:   .|.|       :.:...||       |.|.:     ||
  Rat   248 GGSMTSVGRVPSPGSDTLEMINEV---EPPA-------SRAGAGTE-------PSPKQPVAEGLL 295

  Fly   316 T---PFLNTQAHSQ 326
            |   |||:....||
  Rat   296 TALQPFLSESLVSQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 52/146 (36%)
SPFH_SLP-4 112..319 CDD:259813 62/225 (28%)
Stoml1NP_001292167.1 PHB 77..217 CDD:214581 51/141 (36%)
SPFH_SLP-1 94..224 CDD:259814 45/134 (34%)
SCP2 304..395 CDD:280250 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.