DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Stoml2

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001026816.1 Gene:Stoml2 / 298203 RGDID:1308285 Length:353 Species:Rattus norvegicus


Alignment Length:272 Identity:74/272 - (27%)
Similarity:133/272 - (48%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDY-YPVDLRTVSFDVPPQEVLS 149
            |.:..|.|  |.:.|..|:.||||...  ...||:..::|.:|.. |...|:.:..:||.|..::
  Rat    33 PRNTVILF--VPQQEAWVVERMGRFHR--ILEPGLNVLIPVLDRIRYVQSLKEIVINVPEQSAVT 93

  Fly   150 KDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQ 214
            .|:||:.:|.|:|.||.||.||...|.:..::.:.||.||:|:.||..:|.::..|||:::..:.
  Rat    94 LDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIV 158

  Fly   215 MSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKS---------- 269
            .::::|.|.||::..|.||||:.:|..::.:|..:.||.|..||.|:.:||..:|          
  Rat   159 DAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQ 223

  Fly   270 --------------SRALREASEIIS---ASPSALQL--------------------RYLQTLSS 297
                          ::|..|||.:::   |...|:::                    :|:...|.
  Rat   224 AQILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAGALTQHNGDAAASLTVAEQYVSAFSK 288

  Fly   298 ISTEKNSTIIFP 309
            ::.:.| |::.|
  Rat   289 LAKDSN-TVLLP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 50/147 (34%)
SPFH_SLP-4 112..319 CDD:259813 64/246 (26%)
Stoml2NP_001026816.1 HflC 38..314 CDD:223407 73/267 (27%)
SPFH_paraslipin 74..184 CDD:259811 38/109 (35%)
Band_7_C 259..321 CDD:292817 5/42 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.