Sequence 1: | NP_001259699.1 | Gene: | CG33253 / 2768889 | FlyBaseID: | FBgn0030992 | Length: | 414 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026816.1 | Gene: | Stoml2 / 298203 | RGDID: | 1308285 | Length: | 353 | Species: | Rattus norvegicus |
Alignment Length: | 272 | Identity: | 74/272 - (27%) |
---|---|---|---|
Similarity: | 133/272 - (48%) | Gaps: | 53/272 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 PISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDY-YPVDLRTVSFDVPPQEVLS 149
Fly 150 KDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQ 214
Fly 215 MSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKS---------- 269
Fly 270 --------------SRALREASEIIS---ASPSALQL--------------------RYLQTLSS 297
Fly 298 ISTEKNSTIIFP 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33253 | NP_001259699.1 | PHB | 92..239 | CDD:214581 | 50/147 (34%) |
SPFH_SLP-4 | 112..319 | CDD:259813 | 64/246 (26%) | ||
Stoml2 | NP_001026816.1 | HflC | 38..314 | CDD:223407 | 73/267 (27%) |
SPFH_paraslipin | 74..184 | CDD:259811 | 38/109 (35%) | ||
Band_7_C | 259..321 | CDD:292817 | 5/42 (12%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 324..353 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0330 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |