DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Stom

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001011965.1 Gene:Stom / 296655 RGDID:1305109 Length:284 Species:Rattus norvegicus


Alignment Length:278 Identity:164/278 - (58%)
Similarity:216/278 - (77%) Gaps:10/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HQSSQHAVHIPPPPSLPYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERA 102
            |..||   .:|       :..:.:...::|....:...||.:.:::|||||::||.|:|.||||.
  Rat     9 HVQSQ---RVP-------ESFRDNSKAELGPCGWILVAVSFIFVLITFPISIWICIKIVKEYERV 63

  Fly   103 VIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRISD 167
            :|||:||:..|||:|||:||:|||.|.:..||:||:|||:||||||:|||||::||.|||||:.:
  Rat    64 IIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEVLTKDSVTISVDGVVYYRVQN 128

  Fly   168 PLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERVE 232
            ...||..:.|...:|.|||.|||||.|||:|||::|::||.|:|.||.:||:|||.||:||||||
  Rat   129 ATLAVANITNADSATRLLAQTTLRNALGTKNLSQILSDREEIAHHMQSTLDDATDDWGIKVERVE 193

  Fly   233 IKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKSSRALREASEIISASPSALQLRYLQTLSS 297
            ||||.||..||||||||||||||||||||||||||.:||||:|||.:|:.||:||||||||||::
  Rat   194 IKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTT 258

  Fly   298 ISTEKNSTIIFPLPMELL 315
            |:.||||||:||||:::|
  Rat   259 IAAEKNSTIVFPLPIDML 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 91/146 (62%)
SPFH_SLP-4 112..319 CDD:259813 139/204 (68%)
StomNP_001011965.1 PHB 53..204 CDD:214581 93/150 (62%)
SPFH_stomatin 73..274 CDD:259801 138/200 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.