DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Stoml3

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001099901.1 Gene:Stoml3 / 295041 RGDID:1311090 Length:107 Species:Rattus norvegicus


Alignment Length:70 Identity:27/70 - (38%)
Similarity:46/70 - (65%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PPSLPYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGG 114
            |..|....|..:....:|....:...:|.|:|::|||:|:::|.|::.||||||:||:||:::..
  Rat     4 PEKLEKNNLVGTNKSRLGVCGWILFFLSFLLMLITFPVSIWMCLKIIKEYERAVVFRLGRIQADK 68

  Fly   115 ARGPG 119
            |:|||
  Rat    69 AKGPG 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 16/28 (57%)
SPFH_SLP-4 112..319 CDD:259813 4/8 (50%)
Stoml3NP_001099901.1 SPFH_like 44..>73 CDD:302763 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.