DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Stoml3

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_694796.1 Gene:Stoml3 / 229277 MGIID:2388072 Length:287 Species:Mus musculus


Alignment Length:266 Identity:148/266 - (55%)
Similarity:204/266 - (76%) Gaps:0/266 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PPSLPYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGG 114
            |..|....|..:....:|....:...:|.|:|::||||||::|.|::.||||||:||:||:::..
Mouse     4 PEKLEKNNLVGTNKSRLGVCGWILFFLSFLLMLVTFPISVWMCLKIIKEYERAVVFRLGRIQADK 68

  Fly   115 ARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYS 179
            |:|||:..||||:|.:..||||||:.::||||:|::||||..||.||||||...:.||..|.:..
Mouse    69 AKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVH 133

  Fly   180 HSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSLPTALQR 244
            .:|.|||.|||||||||:.||::|:.||.|:|::|..||:||:.||::|.|||||||.:|..|||
Mouse   134 QATFLLAQTTLRNVLGTQTLSQILSGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQR 198

  Fly   245 AMAAEAEAAREARAKVIAAEGEMKSSRALREASEIISASPSALQLRYLQTLSSISTEKNSTIIFP 309
            :|||||||.|||||||:||||||.:|::|:.||.:::.||.||||||||||::::|||||||:||
Mouse   199 SMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPVALQLRYLQTLTTVATEKNSTIVFP 263

  Fly   310 LPMELL 315
            |||.:|
Mouse   264 LPMNIL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 82/146 (56%)
SPFH_SLP-4 112..319 CDD:259813 123/204 (60%)
Stoml3NP_694796.1 PHB 45..200 CDD:214581 86/154 (56%)
SPFH_like 69..267 CDD:302763 121/197 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.