DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and STOM

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_004090.4 Gene:STOM / 2040 HGNCID:3383 Length:288 Species:Homo sapiens


Alignment Length:289 Identity:166/289 - (57%)
Similarity:219/289 - (75%) Gaps:8/289 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QHQSSQHAVHIPPPPSLPYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISVFICFKVVSEYER 101
            :|.....|..:|       ...|.|.:..:|....:....|.|..|:|||||:::|.|::.||||
Human     5 RHTRDSEAQRLP-------DSFKDSPSKGLGPCGWILVAFSFLFTVITFPISIWMCIKIIKEYER 62

  Fly   102 AVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRIS 166
            |:|||:||:..|||:|||:||:|||.|.:..||:||:|||:||||:|:|||||::||.|||||:.
Human    63 AIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQ 127

  Fly   167 DPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERV 231
            :...||..:.|...:|.|||.|||||||||:|||::|::||.|:|.||.:||:|||.||:|||||
Human   128 NATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERV 192

  Fly   232 EIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKSSRALREASEIISASPSALQLRYLQTLS 296
            |||||.||..|||||||||||:||||||||||||||.:||||:|||.:|:.||:||||||||||:
Human   193 EIKDVKLPVQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLT 257

  Fly   297 SISTEKNSTIIFPLPMELLTPFLNTQAHS 325
            :|:.||||||:||||:::|...:..: ||
Human   258 TIAAEKNSTIVFPLPIDMLQGIIGAK-HS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 91/146 (62%)
SPFH_SLP-4 112..319 CDD:259813 138/206 (67%)
STOMNP_004090.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 4/23 (17%)
SPFH_stomatin 73..274 CDD:259801 137/200 (69%)
Required for homooligomerization 265..273 6/7 (86%)
Required for lipid raft association 267..269 1/1 (100%)
Interaction with LANCL1. /evidence=ECO:0000269|PubMed:9512664 273..287 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.680

Return to query results.
Submit another query.