DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Phb

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_032857.1 Gene:Phb / 18673 MGIID:97572 Length:272 Species:Mus musculus


Alignment Length:243 Identity:61/243 - (25%)
Similarity:107/243 - (44%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RAVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVL--SKDSVTVTVDAVVYY 163
            |||||...|.......|.|..|::|.|......|.|:...:||   |:  |||...|.:...:.:
Mouse    35 RAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVP---VITGSKDLQNVNITLRILF 96

  Fly   164 R-ISDPLKAVIQVYNYSHSTSLLAATT---LRNVLGTRNLSELLTERETISHTMQMSLDEATDPW 224
            | ::..|..:.......:...:|.:.|   |::|:...:..||:|:||.:|..:...|.|....:
Mouse    97 RPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATF 161

  Fly   225 GVKV---------------ERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKSSRALR 274
            |:.:               |.||.|.|:...| :||.....:|.::.:|.:|:|||:.|::..: 
Mouse   162 GLILDDVSLTHLTFGKEFTEAVEAKQVAQQEA-ERARFVVEKAEQQKKAAIISAEGDSKAAELI- 224

  Fly   275 EASEIISASPSALQLRYLQTLSSI----STEKNST-------IIFPLP 311
             |:.:.:|....::||.|:....|    |..:|.|       ::..||
Mouse   225 -ANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 40/158 (25%)
SPFH_SLP-4 112..319 CDD:259813 55/232 (24%)
PhbNP_032857.1 SPFH_prohibitin 27..221 CDD:259799 50/189 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.