DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and mec-2

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001368712.1 Gene:mec-2 / 180826 WormBaseID:WBGene00003166 Length:1239 Species:Caenorhabditis elegans


Alignment Length:261 Identity:173/261 - (66%)
Similarity:214/261 - (81%) Gaps:0/261 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KTSENDDMGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFV 123
            |.:..::.|....:.|::|.|::..|.|||..:|.|||.|||||||||:|||..|||:|||:||:
 Worm   107 KANIQNEFGVCGWILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFI 171

  Fly   124 LPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAAT 188
            :||:|.|..||||.:||:|||||:||||||||.||||||:|||:...:|..|.:.:.||.|||.|
 Worm   172 VPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQT 236

  Fly   189 TLRNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAA 253
            ||||:|||:.|:|:|::||.|||.||.:|||||:||||||||||:|||.||..||||||||||||
 Worm   237 TLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAA 301

  Fly   254 REARAKVIAAEGEMKSSRALREASEIISASPSALQLRYLQTLSSISTEKNSTIIFPLPMELLTPF 318
            ||||||||.||||.|:||||:||:|:|:.|||||||||||||:|||.|||||||||.|::||:.|
 Worm   302 REARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 366

  Fly   319 L 319
            |
 Worm   367 L 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 99/146 (68%)
SPFH_SLP-4 112..319 CDD:259813 146/206 (71%)
mec-2NP_001368712.1 SPFH_stomatin 160..361 CDD:259801 144/200 (72%)
PTZ00121 <571..>913 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H82174
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - O PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.