DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and unc-24

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001355386.1 Gene:unc-24 / 177594 WormBaseID:WBGene00006761 Length:443 Species:Caenorhabditis elegans


Alignment Length:271 Identity:74/271 - (27%)
Similarity:135/271 - (49%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 DD---MGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLP 125
            ||   :..:|:|...||.|.:|:|.|:|:....|.:|..|:.|:.|:||.:.  .||||:..|:|
 Worm    99 DDIKPLSAIELLIFCVSFLFVVMTMPLSLLFALKFISTSEKLVVLRLGRAQK--TRGPGITLVIP 161

  Fly   126 CVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTL 190
            |:|..:.|.:...:|:|||.::::.|...|.:.|.|:.:|.||:.||..|.:.:.|...||.|.|
 Worm   162 CIDTTHKVTMSITAFNVPPLQIITTDRGLVELGATVFLKIRDPIAAVCGVQDRNASVRTLANTML 226

  Fly   191 RNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSL--------PTALQRAMA 247
            ...:..:.    :.:.|..|.|.|         :||::..|||.||.:        .:||  :..
 Worm   227 YRYISKKR----ICDDELGSFTCQ---------FGVEITDVEISDVKIVKEGENMGMSAL--SSV 276

  Fly   248 AEAEAAR----------EARAKVIAAEGEMKSSRALREASEIISASPS----------ALQLRYL 292
            |:::|.:          |..||..|||.:.|.:..|.:.|::.|.|.:          ::.:.:|
 Worm   277 AKSDAGQQLWQVIGPVFEDFAKECAAEEKAKENAPLVDLSDVPSTSAAGTSTDTPNIPSIDIDHL 341

  Fly   293 QTLSSISTEKN 303
            .:::|::.:::
 Worm   342 ISVASLAMDEH 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 46/154 (30%)
SPFH_SLP-4 112..319 CDD:259813 56/220 (25%)
unc-24NP_001355386.1 SPFH_like 146..263 CDD:388510 41/131 (31%)
SCP2 338..437 CDD:376720 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.