DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and phb-1

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_490929.1 Gene:phb-1 / 171768 WormBaseID:WBGene00004014 Length:275 Species:Caenorhabditis elegans


Alignment Length:252 Identity:61/252 - (24%)
Similarity:109/252 - (43%) Gaps:41/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ERAVIFRMGRLRSGGAR----GPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVL----SKDSVTVT 156
            :|||||.    |..|.:    |.|..|::|.|......|:|:.     |:.|.    |||...|.
 Worm    37 QRAVIFD----RFSGVKNEVVGEGTHFLIPWVQKPIIFDIRST-----PRAVTTITGSKDLQNVN 92

  Fly   157 VDAVVYYRIS-DPLKAVIQVYNYSHSTSLLAATT---LRNVLGTRNLSELLTERETISHTMQMSL 217
            :...:.:|.| |.|..:.......::..:|.:.|   |:.|:...:..|::|:||.:|....::|
 Worm    93 ITLRILHRPSPDRLPNIYLNIGLDYAERVLPSITNEVLKAVVAQFDAHEMITQREVVSQRASVAL 157

  Fly   218 DEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREAR--------------AKVIAAEGEMK 268
            .|....:|:.::.:.|..::.......|:..:..|.:||.              |.|..|||:.:
 Worm   158 RERAAQFGLLLDDIAITHLNFGREFTEAVEMKQVAQQEAEKARYLVEKAEQMKIAAVTTAEGDAQ 222

  Fly   269 SSRALREASEIISASPSALQLRYLQTLSSISTE--KNSTIIFPLPMELLTPFLNTQA 323
            :::.|.:|  ..||....::||.::....|:..  ||..:.: ||....| .||.|:
 Worm   223 AAKLLAKA--FASAGDGLVELRKIEAAEEIAERMAKNKNVTY-LPGNQQT-LLNLQS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 37/150 (25%)
SPFH_SLP-4 112..319 CDD:259813 52/234 (22%)
phb-1NP_490929.1 PHB 29..190 CDD:214581 38/161 (24%)
SPFH_prohibitin 30..220 CDD:259799 45/191 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.