DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Nphs2

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_570841.3 Gene:Nphs2 / 170672 RGDID:620461 Length:383 Species:Rattus norvegicus


Alignment Length:315 Identity:133/315 - (42%)
Similarity:197/315 - (62%) Gaps:30/315 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QHRARL-------HVGSPGSGGIQASSSTETFPLTPQHQSSQHAVHIPPPPSLPYQGLKTSENDD 65
            :|||..       .|.|||..|      ||...|....:              |.:|:|.|   .
  Rat    56 EHRAPAATVVNVDEVRSPGEEG------TEVVALLESER--------------PEEGIKPS---G 97

  Fly    66 MGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDY 130
            :|..|.|..:.|::.:::|||.|::.|.|||.||||.:|||:|.|..|.|:|||:||.|||:|.|
  Rat    98 LGACEWLLVLSSLIFIIVTFPFSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTY 162

  Fly   131 YPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLG 195
            :.||||..:.::|..||::||...:.:|||.|||:.:....:..:.:.|.:...|..||::.:|.
  Rat   163 HKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLA 227

  Fly   196 TRNLSELLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKV 260
            .|:|:|:|.||::|:..::::||..|..||:||||.|||||.||..||.::|.||||.|:|:.:|
  Rat   228 HRSLTEILLERKSIAQDVKVALDSVTCVWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRV 292

  Fly   261 IAAEGEMKSSRALREASEIISASPSALQLRYLQTLSSISTEKNSTIIFPLPMELL 315
            ||||||..:|.:||.|:||:|.:|:|:|||||.||.|:||:|.||::.|||.::|
  Rat   293 IAAEGEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTDKPSTVVLPLPFDML 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 66/146 (45%)
SPFH_SLP-4 112..319 CDD:259813 97/204 (48%)
Nphs2NP_570841.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73 4/16 (25%)
SPFH_podocin 122..344 CDD:259809 108/221 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354434
Domainoid 1 1.000 58 1.000 Domainoid score I10528
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.