DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and Nphs2

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_569723.1 Gene:Nphs2 / 170484 MGIID:2157018 Length:385 Species:Mus musculus


Alignment Length:302 Identity:129/302 - (42%)
Similarity:193/302 - (63%) Gaps:23/302 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VGSPGSGGIQASSSTETFPLTPQHQSSQHAVHIPPPPSLPYQGLKTSENDDMGCVEILATVVSVL 79
            |..||..|      ||...|....:              |.:|:|.|   .:|..|.|..:.|::
Mouse    72 VRGPGEEG------TEVVALLESER--------------PEEGIKPS---GLGACEWLLVLASLI 113

  Fly    80 IMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPP 144
            .:::|||.|::.|.|||.||||.:|||:|.|..|.|:|||:||.|||:|.|:.||||..:.::|.
Mouse   114 FIIMTFPFSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPF 178

  Fly   145 QEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETI 209
            .||::||...:.:|||.|||:.:....:..:.:.|.:...|..||::.:|..|:|:|:|.||::|
Mouse   179 HEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSLTEILLERKSI 243

  Fly   210 SHTMQMSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKSSRALR 274
            :..::::||..|..||:||||.|||||.||..||.::|.||||.|:|:.:|||||||..:|.:||
Mouse   244 AQDVKVALDAVTCIWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAAEGEKAASESLR 308

  Fly   275 EASEIISASPSALQLRYLQTLSSISTEKNSTIIFPLPMELLT 316
            .|:||:|.:|:|:|||||.||.|:||||.:|::.|||.::|:
Mouse   309 MAAEILSGTPAAVQLRYLHTLQSLSTEKPATVVLPLPFDMLS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 66/146 (45%)
SPFH_SLP-4 112..319 CDD:259813 97/205 (47%)
Nphs2NP_569723.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
SPFH_podocin 124..346 CDD:259809 108/221 (49%)
PHB 125..289 CDD:214581 75/163 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.