DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and STOML3

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_660329.1 Gene:STOML3 / 161003 HGNCID:19420 Length:291 Species:Homo sapiens


Alignment Length:281 Identity:148/281 - (52%)
Similarity:208/281 - (74%) Gaps:14/281 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TPQHQSSQHAVHIPPPPSLPYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISVFICFKVVSEY 99
            :|:.|..::.|.:              .|..:|....:...:|.|::::|||||:::|.|::.||
Human     7 SPEKQDKENFVGV--------------NNKRLGVCGWILFSLSFLLVIITFPISIWMCLKIIKEY 57

  Fly   100 ERAVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYR 164
            ||||:||:||:::..|:|||:..||||:|.:..||||||:.::||||:|::||||..||.|||||
Human    58 ERAVVFRLGRIQADKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYR 122

  Fly   165 ISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVE 229
            |...:.||..|.:...:|.|||.|||||||||:.||::|..||.|:|::|..||:||:.||::|.
Human   123 IYSAVSAVANVNDVHQATFLLAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVA 187

  Fly   230 RVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKSSRALREASEIISASPSALQLRYLQT 294
            |||||||.:|..|||:|||||||.|||||||:||||||.:|::|:.||.:::.||.|||||||||
Human   188 RVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLRYLQT 252

  Fly   295 LSSISTEKNSTIIFPLPMELL 315
            ||:::|||||||:|||||.:|
Human   253 LSTVATEKNSTIVFPLPMNIL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 82/146 (56%)
SPFH_SLP-4 112..319 CDD:259813 124/204 (61%)
STOML3NP_660329.1 SPFH_like 73..271 CDD:327503 122/197 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.680

Return to query results.
Submit another query.