DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and PHB2

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001138303.1 Gene:PHB2 / 11331 HGNCID:30306 Length:299 Species:Homo sapiens


Alignment Length:245 Identity:62/245 - (25%)
Similarity:112/245 - (45%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SVFICFKVVSEYERAVIF-RMGRLRSGGARGPGVFFVLPCVDDYYPV--DLRTVSFDVPPQEVL- 148
            |||    .|....||:.| |:|.::.......|:.|.:|...  ||:  |:|     ..|:::. 
Human    39 SVF----TVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQ--YPIIYDIR-----ARPRKISS 92

  Fly   149 ---SKDSVTVTVDAVVYYR-ISDPLKAVIQVYNYSHSTSLLAA---TTLRNVLGTRNLSELLTER 206
               |||...|.:...|..| .:..|.::.|.....:...:|.:   ..|::|:...|.|:|:|:|
Human    93 PTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQR 157

  Fly   207 ETISHTMQMSLDEATDPWGVKVERVEIKDVSL----PTALQRAMAAEAEAAR----------EAR 257
            ..:|..::..|.|....:.:.::.|.|.::|.    ..|::....|:.||.|          |.|
Human   158 AQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQR 222

  Fly   258 AKVIAAEGEMKSSRALREASEIISASPSALQLRYLQTLSSIS----TEKN 303
            .|::.||||.::::.|.||   :|.:|..::||.::...:||    |.:|
Human   223 QKIVQAEGEAEAAKMLGEA---LSKNPGYIKLRKIRAAQNISKTIATSQN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 36/161 (22%)
SPFH_SLP-4 112..319 CDD:259813 53/220 (24%)
PHB2NP_001138303.1 Necessary for transcriptional repression. /evidence=ECO:0000269|PubMed:10359819 19..49 4/13 (31%)
SPFH_prohibitin 40..235 CDD:259799 50/205 (24%)
LC3-interaction region. /evidence=ECO:0000269|PubMed:28017329 121..124 1/2 (50%)
Necessary for transcriptional repression. /evidence=ECO:0000269|PubMed:10359819 150..174 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.